15,190 Topics
 | |
| | my assignment is to write a program that asks the user to enter the name of the artist, the name of the art and then how much it is worth. At the end the program should print the average of the values. After that, it wants the program to sort …  |
| | Hi My txt file looks something like this: Branch: ltm_7.4 Destination: Test 5 [CODE] lines = open("branch_dest.txt").readlines() lines=[x.split() for x in lines] print lines branch = "%s" % lines[0][1].strip(': ') print branch destination = "%s" % lines[1][2].strip(': ') print destination [/CODE] I need to extract the branch name and the … |
| | i'm pretty clueless about everything dealing with python. i need help creating a sorting algorithm that can sort names in a list alphabetically. and example code to help get me started would be much appreciated. |
| | Hi everybody! I'm facing a really tricky problem in python. I am using the pyserial package to communicate with an external serial interface board. The board accepts certain hexadecimal strings as commands in the following form : --example-- command1 : "\x02\xa1" command2 : "\x03\xa2\xb5" etc... Some of the commands are … |
| | Hi, I want to access a link starting with clients_test on a particular webpage. I have the following code client_re = re.compile(r"clients_test") def get_client_url(): url = get_artifacts_url() for link in get_links(url): if client_re.search(link["href"]): return "http://11.12.13.27:8080" + link["href"] Sometimes the page has many links beginnng with clients_test for e.g: clients_test4, clients_test5, … |
| | I started to think how to create up and down style loop, and what I ended up was this. Wanted to do it little unconventional way though to demonstrate the property of range as list.[code]for n in range(8): for i in range(n)+range(n-2,-1,-1): print i, print """ Output: 0 0 1 … |
| | I have registered a new Tkinter module @ pypi. tkPickaColor is a dialog intended for Linux coders to provide a more full featured color chooser than is now available. I say for Linux coders since a better chooser is already available on the MS Windows side. It seems to be … |
| | so i have a project due in my computer programming class and i need some serious help. we are learning about recursive sorting, such as merge sort, selection sort, etc. my project has to do with taking 10 people and sorting them in order by their names (alpabetically), rank (numerically), … |
| | Hey guys, I'm pretty inexperienced with Python, but I wanted to give it a shot because I plan on using it on an upcoming visual aid contest. I've been working on a side scrolling type project where you move left and right and the backgrounds scroll across displaying various images. … |
| | Im working on this bit of code below, The only thing im worried about editing atm is the self.toggle() and self.hello(). Im currently getting this error TclError: unknown option "-menu" from this line of code self.config(menu=menubar), does anyone know how i could fix this problem?? [CODE] from Tkinter import * …  |
| | Hey everyone, I need some help on some simple Python programming, below is my problem: Identify numbers or words in any .txt file that aren't listed in a provided .txt file and to output those numbers or words that aren't in the text file one per line, in alphabetical or … |
 | I'm an absolute beginner. Is there a function to search inside a set? If not, does anyone have a function that does so? (set to search in, value to search for) |
| | I am TRYING to write a program that finds restriction sites in a DNA file and returns a picture and information box of the enzyme which cuts it. My problems are; a) I have no idea if my program works past opening the file directory. b) I dont know how … |
| | I'm in the beginning stages of writing (and learning as I go) a Python database app using SQLite. I have the db structure planned on paper, and I have the queries I'll need in mind, but before I start coding I want to fully test the db design to make … |
| | Hi Guys, I'm a beginner programming with Python. This is my first program. The purpose of this program is to add two numbers and then give me the result. However, after that I want for it to ask me if I want to continue (y) or (n). I came with … |
| | I need help creating a python function that makes concentric circles. I already have a function that makes a circle(from the Python Programming book), so I thought I'd use a for loop; however, I'm not sure how. Here's what I have so far: (where 'number' is the number of circles, … |
| | I'm trying to make quiz GUI. The GUI has one button and an entry box. The user presses the button and it asks a random question from using the world database. After 10 questions, it tells you the number correct and incorrect. I'm having a lot of trouble with the … |
 | Hi I want to compile py files to com files. Please help me. thanks. |
| | Im trying to make a bac calculator and make a gui for it but am having issues with the math code for it. Here's my code. Everything I input returns 0. The BAC forumula is (150/body weight)(% alcohol/50)(ounces consumed)(0.025). Btw, I suck at math so it could be a math … |
| | hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] … |
| | I am using scipy distribution scipy-0.4.9.win32-py2.4.exe with python 2.4 on Windows XP. When I try to import scipy I get the following error. [code] Traceback (most recent call last): File "<pyshell#4>", line 1, in ? from scipy import * File "D:\Python24\lib\site-packages\scipy\__init__.py", line 33, in ? del lib NameError: name 'lib' … |
| | Here is some saved interaction in command prompt. [CODE]>>> type((1,2)) <type 'tuple'> >>> (3*x for x in (4,4)) <generator object <genexpr> at 0x00E73EB8> >>> tuple(x**2 for x in range(10)) (0, 1, 4, 9, 16, 25, 36, 49, 64, 81) >>> set(x for x in range(10)) set([0, 1, 2, 3, 4, … |
 | I'm working on an addon system for one of my projects. I'm able to add a new menu item, but the self.Bind(...) is causing me troubles instead of bind the function to the menu-item, it just calls the function. and doesn't bind at all... :s [code=python]self.ID_OPEN=wx.NewId() wxglade_tmp_menu.Append(self.ID_OPEN, eval(menucontent)[i][0], "", eval("wx.ITEM_"+eval(menucontent)[i][1])) … |
| | Attached are a C file, a .i file, and a Makefile that I thought could produce a Python-loadable binary. Also, I included a text file with the output I got showing the failure. It looks like I didn't include something vital but I don't know what. Can anyone help me … |
| | Hi guys, I am a complete newbie (but learning slowly). I am trying to make a script to check for proxies that are contained in a file using a regex. Fact is that I lack of knowledge and I do not know how to make it go. This is my … |
| | I have created an owl ontology using protege.Is dere any way to query the owl ontology n give the results to python code?? |
| | I do have a problem with my connect four code ; it doesn't check whether there is a winner even though the function its okay :-/ Can anyone help me to solve my problem ??? [CODE=python] import random board = dict() rows,columns = 4,4 def game(): choose_player() #MAKE BOARD FUNCTION … |
| | Hi, Does anyone have an example of code in wxpython that moves a sprite across an image background? Or can point me to an url that shows an example? Thanks |
| | This problem came up in one thread and here is my finalised version to follow changes of files in list of paths given. |
| | I'm working on an add-on system, which is till now going pretty good. no I need to assign an id to a menu item, but I don't know which are all in use (by other addons f.e.) so is there a way to either: -get a random integer that isn't … |
The End.