15,175 Topics
 | |
| | Hi, Gribouillis, helped me to understand how to invoke a function by btn click event handler, at my last post.Now I am trying to understand how I can handle an selected item event from a list box? lets say I have a list box like below and I want to …  |
| | Hi there, I'm kind of new to python and I'm trying to extract a protein sequence from this webpage... [url]http://www.ncbi.nlm.nih.gov/protein/BAH23558.1[/url] When I use urllib.urlopen the html it gets does not contain the sequence data. When I open this page in firefox and use firebug to look at the page I … |
| | Hello all, i was working on an R script that will read a huge text file and make some calculation inside it, but i figured out that it will need long time to do the job , so i'm trying to convert it into python. is there any way to …  |
| | I have a string that looks like: IiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi I want to to capture all the segments that have H's in them and return their respective start & stop string positions. [CODE] tms = re.compile("H+") print tms.findall(string) [/CODE] This will find all the Hs but I cant get the string positions … |
| | I've tried to make the code below to solve one of the Euler equation for the Gas Dynamics. I understand my code is not perfect, that is why I'm getting an error which I don't understand. The error message is: " File "eulersys.py", line 50, in <module> u_data = Evolve_in_One_Timestep(u_data) … |
| | So, I found a snipped of code that did what I was looking for but I tried adding upon it to fit my need a little more. What I am trying to do is input an integer and return an 8 bit binary string to a list. My first problem … |
| | I am trying to delete a cookie by reseting it but it wont delete. What am i doing wrong [CODE]#!/usr/bin/python import cgi import Cookie import os def cookie_expiry_date(numdays): from datetime import date, timedelta new = date.today() + timedelta(days = numdays) return new.strftime("%a, %d-%b-%Y 23:59:59 GMT") print 'Set-Cookie: UserID=0; expires= '+cookie_expiry_date(-100); … |
| | I am looking for step by step details of how to deploy django websites in apache2 server with one example. I am using ubuntu operating system Please give some link or give the details. |
 | Hello friends, I want to write simple script to download youtube videos, but I have problem... I use One-liner for this, the file is downloaded but it's empty (0 bytes). Can someone help me about my problem ? Here is my code: [CODE=python] # Author: Abhinay Omkar # Title: One-liner … |
| | I believe the Python thread is the most appropriate place to post a Django question :P Hi there guys and girls! I am currently busy (and learning) Django. It really is a solid platform to work on compared to PHP. Ok let me get to the point :P I am … |
| | I don't know if you could fix this code.. but there is something wrong with it or with me.. i don't know which.. here is the code for the .py script [CODE]import string import sys # input if len(sys.argv) < 2: print "Not enough arguments, quitting." quit() if len(sys.argv) > … |
| | I literally hate to ask this question but I am having trouble with Qt 4 basically all I am trying to do is clear the textEdit area with clear() but I am not sure of what to do. In C++ I would just [CODE]textEdit->clear();[/CODE] and it would do so. I …  |
| | Can someone please show me the best way to achieve this with the least amount of lines? Im a recovering PHP coder, I have one solution. I was wondering if there was a quicker more pythony way to do this: I have in "results" [ICODE][('Basp1', 'Aen2'), ('Basp1', 'Ahy18'), ('Basp1', 'Ahy26'), … |
| | hi all i hav a list like list = ['0', '344', '1', '345', '2', '346', '3', '347', '4', '348', '5', '349', '6', '350', '7', '351', '8', '352', '9', '353', '10', '354', '11', '355', '12', '356', '13', '357', '14', '358', '15', '359', '16', '360', '17', '361', '18', '512', '19', '513', '20', … |
| | This is my class project to be made in pythonCard : A local community centre desires to have a user friendly application to keep track of their community members. The application must allow a user to display information about community members, including the list of activities that individual members are … |
| | hello, small question if i may :-) [CODE] try: x=int(input()) except ValueError as var: print(str(var.args[0])) [/CODE] if i input a string like - abcd this code prints me the full error message invalid literal for int() with base 10: 'abcd' while i need only the input - abcd to be … |
| | How do I call a batch file in jython? thanks!! |
| | Hey everybody. All my Google searches for help led me here so I thought I'd post my actual problem directly. I'm in a 101 programming course and this is only our second Python assignment. What I need to do is use one-dimensional parallel arrays to allow input of four different … |
| | The problem is that I want login to a remote pc using ssh through a python script. I don't want to use any ssh-keys (rsa keys,dsa keys etc.) nor do I want to use some extra module not incorporated in python standard libraries (telnet etc I guessed it is used … |
| | Hi, I got the cxfreeze working on the Mac OS X 10.6.7 and the distilled Python script runs fine on that Mac Book. Now I'm getting reports from Mac user clients that it doesn't work for them. It is a simple script that only calls from the Mac it's terminal. … |
| | Hi, Is there a way to get the full path of my war file in jython?? I have war file (myApp.war) that is stored in D:\myConstantDirectory\myApp.war I want to create a jython script that can retrieve the full path of my war file by just specifying search myApp.war and it … |
| | I have made a very simple dice game, How can i output the results of the dice using this format. Thanks for your time. [CODE] ========== | 0 | | | | 0 | ========== ========== | 0 0 | | 0 0 | | 0 0 | ========== [/CODE] …  |
| | Hey guys, I hate asking this but unfortunetly, Google does not know how to interpret "|" and probably assumes its an OR command or something :P . The line goes as follows (source found [URL="http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html"]http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html[/URL] here): [CODE]st.st_mode = stat.S_IFDIR | 0755[/CODE] I know it's doing something about the mode being … |
| | I get this python error: unindent does not match any outer indentation level, and a red bar appears where "RIGHT HERE RED" is.., keep in mind that this is just a fraction of the entire program but i dont know where the spacing error occurs... pleeeaaase i beg you and … |
 | Hi all, Here is a part of my code: [CODE]#-- if the ports are mapped properly if(map_dict1[int(MIO_outports1[i])] == int(Exp_map_inport[i]) ): flag = 1 elif(map_dict2[int(MIO_outports1[i])] == int(Exp_map_inport[i])): flag = 1 else: flag = 0 [/CODE] But I am not able to navigate to the 'elif' part. I am getting : [CODE] … |
| | Hi! I have a batch file (potchi.bat) that contains the lines ... set maxHeap = 2048 set initialHeap = 512 set mydir=%cd% ... and I want to pass these values to a jython script (myScript.py) such that fullpath = '%cd%/myApp.war' AdminApp.installInteractive(fullpath, -contextroot myApp) AdminTask.setJVMMaxHeapSize('[-serverName myServer -nodeName myNode -maximumHeapSize %maxHeap%]') AdminTask.setJVMInitialHeapSize('[-serverName … |
| | hi guy just started python, i have a text here and want wo find the number of each letters, and sort the number from the most frequent to the least frequent. hope you guys can hepe me here is the text, just some random letters, acbbmnhctrgnmmxfnfbmqrhnchfwcqwtacvtfhmecttvfcnvphchmpgdmebjdcqwhdfnfrcawhdfrkanahtcjaqxahpkmqdardfcnhcqwjmprdcttvfpkdftwaqbmnfhdcqhdarcrhdfzmnwrzfnfrkmsfqhdfjkcrrfwhdnmpxdhdfzcttcqwrhmmwpkmqcqmkfqgmpqhnjnmcwzahdeaftwrmqfahdfndcqwhdfgahjdcwfqhanftjlcqardfwqmhclfrhaxfmeahzcrhmvfrffqhdfwcnsqfrrcqwhdfbarhdcwlcqardfwzahdahemnahzcrcgtfcngmtwzaqhfnwcjzahdrqmzpkmqhdfxnmpqwxmmwdfclfqrcawrgnmmxfgtcrkaqxdar |
| | This is hopefully example of properly tested code snippet (fingers crossed). |
| | write a python program , which takes one argument ,which is a word( as a string), and returns "true" if the word contains alternating vowels and consonants(i.e a consonant , followed by a vowel , followed by a consonant ....). Then write a short piece of code to read the … |
 | I have a lot more code than I'm going to post here, but I am posting the relevant parts. What I have is a Calculator program. Here's the code: [CODE=Python] num1 = None num2 = None oper = None def calculate(num1, num2, oper): print("calculate() called") if(oper=="+"): answ = Decimal(num1) + … |
The End.