15,194 Topics
![]() | |
I literally hate to ask this question but I am having trouble with Qt 4 basically all I am trying to do is clear the textEdit area with clear() but I am not sure of what to do. In C++ I would just [CODE]textEdit->clear();[/CODE] and it would do so. I … | |
Can someone please show me the best way to achieve this with the least amount of lines? Im a recovering PHP coder, I have one solution. I was wondering if there was a quicker more pythony way to do this: I have in "results" [ICODE][('Basp1', 'Aen2'), ('Basp1', 'Ahy18'), ('Basp1', 'Ahy26'), … | |
hi all i hav a list like list = ['0', '344', '1', '345', '2', '346', '3', '347', '4', '348', '5', '349', '6', '350', '7', '351', '8', '352', '9', '353', '10', '354', '11', '355', '12', '356', '13', '357', '14', '358', '15', '359', '16', '360', '17', '361', '18', '512', '19', '513', '20', … | |
This is my class project to be made in pythonCard : A local community centre desires to have a user friendly application to keep track of their community members. The application must allow a user to display information about community members, including the list of activities that individual members are … | |
hello, small question if i may :-) [CODE] try: x=int(input()) except ValueError as var: print(str(var.args[0])) [/CODE] if i input a string like - abcd this code prints me the full error message invalid literal for int() with base 10: 'abcd' while i need only the input - abcd to be … | |
How do I call a batch file in jython? thanks!! | |
Hey everybody. All my Google searches for help led me here so I thought I'd post my actual problem directly. I'm in a 101 programming course and this is only our second Python assignment. What I need to do is use one-dimensional parallel arrays to allow input of four different … | |
The problem is that I want login to a remote pc using ssh through a python script. I don't want to use any ssh-keys (rsa keys,dsa keys etc.) nor do I want to use some extra module not incorporated in python standard libraries (telnet etc I guessed it is used … | |
Hi, I got the cxfreeze working on the Mac OS X 10.6.7 and the distilled Python script runs fine on that Mac Book. Now I'm getting reports from Mac user clients that it doesn't work for them. It is a simple script that only calls from the Mac it's terminal. … | |
Hi, Is there a way to get the full path of my war file in jython?? I have war file (myApp.war) that is stored in D:\myConstantDirectory\myApp.war I want to create a jython script that can retrieve the full path of my war file by just specifying search myApp.war and it … | |
I have made a very simple dice game, How can i output the results of the dice using this format. Thanks for your time. [CODE] ========== | 0 | | | | 0 | ========== ========== | 0 0 | | 0 0 | | 0 0 | ========== [/CODE] … | |
Hey guys, I hate asking this but unfortunetly, Google does not know how to interpret "|" and probably assumes its an OR command or something :P . The line goes as follows (source found [URL="http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html"]http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html[/URL] here): [CODE]st.st_mode = stat.S_IFDIR | 0755[/CODE] I know it's doing something about the mode being … | |
I get this python error: unindent does not match any outer indentation level, and a red bar appears where "RIGHT HERE RED" is.., keep in mind that this is just a fraction of the entire program but i dont know where the spacing error occurs... pleeeaaase i beg you and … | |
Hi all, Here is a part of my code: [CODE]#-- if the ports are mapped properly if(map_dict1[int(MIO_outports1[i])] == int(Exp_map_inport[i]) ): flag = 1 elif(map_dict2[int(MIO_outports1[i])] == int(Exp_map_inport[i])): flag = 1 else: flag = 0 [/CODE] But I am not able to navigate to the 'elif' part. I am getting : [CODE] … | |
Hi! I have a batch file (potchi.bat) that contains the lines ... set maxHeap = 2048 set initialHeap = 512 set mydir=%cd% ... and I want to pass these values to a jython script (myScript.py) such that fullpath = '%cd%/myApp.war' AdminApp.installInteractive(fullpath, -contextroot myApp) AdminTask.setJVMMaxHeapSize('[-serverName myServer -nodeName myNode -maximumHeapSize %maxHeap%]') AdminTask.setJVMInitialHeapSize('[-serverName … | |
hi guy just started python, i have a text here and want wo find the number of each letters, and sort the number from the most frequent to the least frequent. hope you guys can hepe me here is the text, just some random letters, acbbmnhctrgnmmxfnfbmqrhnchfwcqwtacvtfhmecttvfcnvphchmpgdmebjdcqwhdfnfrcawhdfrkanahtcjaqxahpkmqdardfcnhcqwjmprdcttvfpkdftwaqbmnfhdcqhdarcrhdfzmnwrzfnfrkmsfqhdfjkcrrfwhdnmpxdhdfzcttcqwrhmmwpkmqcqmkfqgmpqhnjnmcwzahdeaftwrmqfahdfndcqwhdfgahjdcwfqhanftjlcqardfwqmhclfrhaxfmeahzcrhmvfrffqhdfwcnsqfrrcqwhdfbarhdcwlcqardfwzahdahemnahzcrcgtfcngmtwzaqhfnwcjzahdrqmzpkmqhdfxnmpqwxmmwdfclfqrcawrgnmmxfgtcrkaqxdar | |
This is hopefully example of properly tested code snippet (fingers crossed). | |
write a python program , which takes one argument ,which is a word( as a string), and returns "true" if the word contains alternating vowels and consonants(i.e a consonant , followed by a vowel , followed by a consonant ....). Then write a short piece of code to read the … | |
I have a lot more code than I'm going to post here, but I am posting the relevant parts. What I have is a Calculator program. Here's the code: [CODE=Python] num1 = None num2 = None oper = None def calculate(num1, num2, oper): print("calculate() called") if(oper=="+"): answ = Decimal(num1) + … | |
Hi all, I'm trying to use Python's urllib to get a Facebook profile page. I get the following error: [CODE]IOError: [Errno socket error] [Errno 10035] A non-blocking socket operation could not be completed immediately[/CODE] Here's my code: [CODE] import urllib member_profile_text = urllib.urlopen('http://www.facebook.com/profile.php?id=1073109649').read() [/CODE] I need to get this working … | |
[I]This is one idea for thread of some lessons learned with experience about asking wrong question and answers 'thinking out of box'. If there is need to have sticky, I suggest that this thread become sticky development thread and moderator can move the upvoted suggestions for next part in new … | |
Ive noticed print() includes linebreaks, and its real easy to suppress them. Is there a way I can write lines to a file, but have the line breaks includes implicitly? eg: [CODE] file=open("testfile.txt","w") file.write("line 1") file.write("line 2") file.write("line 3") file.close() [/CODE] meanwhile the file will contain [code] line 1\nline 2\nline … | |
This is inspired for recent poster, who asked to check multiple strings in multiple files. | |
Platform and Python installation info: [b]Platforms: Windows, OS X Python: Active State Python 2.7 wxPython: Version 2.9[/b] Here is a sample code in which I use a wxMessageBox: [code]import wx,os class Frame(wx.Frame): def __init__(self, parent, id, title): wx.Frame.__init__(self, parent, id, title, size=(100, 100),style=wx.MINIMIZE_BOX | wx.SYSTEM_MENU | wx.CAPTION | wx.CLOSE_BOX | … | |
Hi! On school we got exercise to calculate how much the length of substance grow when we know original length and temperature change. So,the case goes that i have value temperature coefficient of different substances and i have to multiply them. I'd like to it without doing several condition statements. … | |
For some reason, I can create temp files but I cannot write to them. Nothing is saved, and the file is always empty. What am I doing wrong? I've tried making it in /tmp, Ive specified mode=w+b, they all do the same. (nothing) [CODE] import tempfile def main(): test = … | |
I am making a last-ditch effort to get Django 1.3 configured to talk to SQL Server (both running on the same Windows 7 system), before I have to make a final decision whether to move on to ASP.NET instead. I am using PyODBC (I had tried PyMSSQL but was recommended … | |
I am reading a Python book for Pyton 2.5 (But I am doing Python 3). I am at the chapter classes and I got this part; "You can check whenever the function attribute was callable." [CODE]callable(tc,'talk',None)[/CODE] In Python3 we do not have callable anymore, so I checked on the internet, … | |
Hi, this program is working atm but i suck at loops and such and im just wondering if there is any better way to do it, and if i do not enter a number in 1 of the 3 boxes when showing the results of the networks it just says … | |
hi all i have list like list1=[2,3,4] m = 'ma' [B]m = list1 * m[/B] wen i run the script i'm getting output like [B]TypeError: can't multiply sequence by non-int[/B] i need a output like [B][ma2,ma3,ma4][/B] so plzzzzz help me:( |
The End.