jice

[QUOTE=RMartins;537916]but how can i prove for example that the result of sqrt(n) is an integer?[/QUOTE] You can do this (maybe is there more elegant way) [CODE] if math.sqrt(n) == float(int(math.sqrt(n))): print "sqrt(n) is an integer" [/CODE]

[CODE] import csv reader = csv.reader(open("c:\sample.dat")) d={} for row in reader: d[row[0]]=row[1:] [/CODE]

Just a quick point. To turn an object into string, you can define the special method __repr__ in your object : [CODE] class myobject: def __init__(self, name): self.name=name def __repr__(self): return "my name is %s" % (self.name) o=myobject("toto") print o > toto [/CODE]

I'd write [CODE] self.cursor.execute("INSERT INTO DatabaseName (C1, C2, C3, C4, C5) SELECT (C1, C2, C3, C4, C5) FROM DatabaseName WHERE C1='%s'", [newC1Value]) [/CODE]

[QUOTE=sys73r;1691325]my bad, the code i got is: input.csv 1,2,text, date, qwertyuiopasdfghjklñzxcvbnm, yhnujmik,2121212121 [CODE]import csv reader = csv.reader(open('input.csv', 'rb'), delimiter=',',quoting=csv.QUOTE_NONNUMERIC)) csv_out = csv.writer(open('output.csv', 'w')) for row in reader: content = row[0] + row[1] + row[5] + row[6] csv_out.writerow( content )[/CODE] which is giving me: 1,2,y,h,n,u,j,m,i,k,2,1,2,1,2,1,2,1,2,1 instead of 1,2,yhnujmik,2121212121 thanks![/QUOTE] Ok with …

This code goes recursively in all the sudirs of your rootdir. Open all the files, read the lines, calls a function to process your line (here, it does nothing) and overwrite your files with your new lines [code=python] import os rootdir='c:\Your\Path' def doWhatYouWant(line): return line for subdir, dirs, files in …

Another method [CODE] import fnmatch pattern = '*.rtf' files = ['doc.txt', 'stuff.rtf', 'artfunction.exe', 'rtfunc.bat', 'doc2.rtf'] print('\n'.join(filename for filename in fnmatch.filter(files, pattern))) [/CODE]

A classical method using list comprehensions [CODE] dict([(list[i], list[i+1]) for i in range(0, len(list), 2)]) [/CODE] function dict takes a list of tuples for arguments and uses the first term of the tuple as key and the second as value If you need more explanations, don't hesitate to ask.

you have to do [code] folder = r'\\192.168.0.12\myshare1' # OR folder = '\\\\192.168.0.12\\myshare1' [/code]

Something like this : [CODE] import random class TV(object): def __init__(self): # self refers to the object itself # Don't mix up an object instance and an object class. # Class is the definition of a type of object (for example TVs all have a brand and channels) # instance …

Here are some function you can look at : - os.listdir(mydir) will list all the files from "mydir" - fnmatch.filter(files_list, "*.txt") will give you a list of all text files in the files_list (tip : fnmatch.filter(os.listdir(mydir)) - os.path.join(mydir, file) will give you the absolute name of the file - os.walk(mydir) …

[CODE] import glob print "\n\n".join(["".join([l for l in open(inf).readlines()[:2]]) for inf in glob.glob("C:\\path\\to\\the\\dir\\*.txt")]) [/CODE]

Hi, You can use () to make it work (if you really want a one liner)... [CODE] def l(): return (lambda ...)() [/CODE] [CODE] def l(): return (lambda x=input("Enter the text to be decrypted: "),y=int(input("Enter the shift amount: ")): print("The decrypted text is: "+"".join(list(map(lambda x: chr(ord(x)+y),x)))))() [/CODE]

Can you put the code you use for writing the content of the chest (i suppose : chest.printChest()) and the datas that are written ? BTW, for this kind of thing, you should have a look at __repr__ function.

[QUOTE=richieking;1491374][CODE]print(["/".join(date.split("-"))])[/CODE] 2011/03/03 from my htc phone ;)[/QUOTE] I'd rather do [CODE] date.replace('-','/') [/CODE]

You can try this : [CODE] protein="GWEIQPYVWDECYRVFYEQLNEEHKKIFKGIFDCIRDNSAPNLATLVRVTTNHFTHEQAMMDAVKFSEVLPHKKMHRDFLEKLGGLSAPVDNHIKGTDFKYKGKAKNVDYCKEWLVL" pp="LLCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHCLLLCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCL" gor="cccccccccccchhhhhhhhhhhhhhhhhhhhhhhccccccccceeeeecccccchhhhhhhhhhhcccchhhhhhhhhhhhhccccccccccccccccccccccceeceeccceec" aber="CCCCCCCCCCCCHHHHHHHCCHHHCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC" print "".join([str(i / 10) for i in range(len(protein))]) print "".join([str(i) for i in range(len(protein))]) print protein print pp print gor print aber [/CODE]

Hello there, I'm trying to generate a open office text document with tables generated from a database with the lpod library. I'd like to set the width of the tables columns but i can't manage it. Here is my test code so far : [code] import lpod.document import lpod.table doc …

hi, I try to write a app to automatically re-organize my mails (thunderbird). The first thing I try is to re-create my folders tree, once for each year. So i need to read mbox files and rewrite them [CODE=python] import mailbox mbx=mailbox.mbox("./in_mbox") mbx.lock() of=open("out_mbox", "w") for k, m in mbx.iteritems(): …

This should work (not tested) [CODE] of = open(my_out_filename, 'w') for line in open(my_in_filename,'r'): if 'STRING' in line or 'INTEGER' in line: of.write(line) of.close() [/CODE]

You can generate csv files... For an easy csv management, there is a csv module [url]http://docs.python.org/library/csv.html[/url]

Have a look at this : [URL="http://www.devshed.com/c/a/Python/Database-Programming-in-Python-Accessing-MySQL/"]http://www.devshed.com/c/a/Python/Database-Programming-in-Python-Accessing-MySQL/[/URL] Others here [url]http://www.devshed.com/googlecse.html?cx=partner-pub-6422417422167576%3A6n32xsl5si9&cof=FORID%3A11&ie=ISO-8859-1&q=mysql+python&sa.x=28&sa.y=9&sa=Search&siteurl=www.devshed.com%2Fc%2Fb%2FPython%2F#1333[/url]

Your datas aren't in a csv format... For csv, here is a simple example to read and write datas [CODE] import csv # This class is to define another csv format if you need to class excel_french(csv.Dialect): delimiter=';' quotechar='"' doublequote=True skipinitialspace=False lineterminator='\n' quoting=csv.QUOTE_MINIMAL fic='yourfile.csv' outcsvfic='out.csv' csv.register_dialect('excel_french', excel_french) cr=csv.reader(open(fic,"r"), 'excel_french') # …

don't forget that, in os.walk, if you remove a dir from "dirs", it's subtree won't be explored. So [code] for dirpath, dirs, files in os.walk(path): for d in dirs: if d.startswith('.'): dirs.remove(d) # d's subtree won't be explored for f in files: if not f.startswith('.'): process_file() [/code]

A better way to deal with text files is rather with for loop : [code] of=open(myoutfilename, 'w') for line in open(myfilename,'r'): print line of.write(line.replace(' ', '\t')) of.close() ######### OR ############## # not sure the 2 with on the same line work (and i can't test it right now) # this …

it's not tennisPro, it's tennis

It's because your class isn't "tennisPro", it's "tennis"

wherever you write : [code] something("%s") % one_variable [/code] write [code] something("%s" % one_variable) [/code]

Just one thing. For line iterating, i find it is a bad idea to load the whole file in a list (using readlines()) except if you can't process it sequentially. This will consume memory for really nothing interesting... Python allows iterating directly on file lines : [CODE] for line in …

Sorry but i don't understand what you want... Can you post your code ? part of your sql files ? How do you execute the content of your sql files ? What do you want to write in your logfile ? Your question in far too open for me to …

Fast method, using sets : [CODE] lines=open(myfile,'r').readlines() uniquelines=set(lines) open(outfile,'w').writelines(uniquelines) [/CODE] which can be done in only one line : [CODE] open(outfile,'w').writelines(set(open(myfile,'r').readlines())) [/CODE]