7,163 Topics
 | |
| | Hi all, I would like my program to be able to search for a string using Google and then use the number of results. I'm not sure what exactly this will entail in I/O terms so I guess I'll leave it at that and see what you guys have to … |
 | Have you found these link building services beneficial? I am looking into link building services and I wonder if they are worth it.  |
| | A few days ago suddenly Google stoped sending visitors .i had like 2000 + visitors from google daily,now i have 100 . i was a suddenly change,not in time . i don't understand, what could be the reason ? my site (here is the www downloadvyp com link for this …  |
| | Hi Friends, If you’re paying for links or building them manually, it’s becoming more and more important to make it look like you’re gaining them naturally. That’s because, as a site owner, you’re supposed to be gaining them naturally, at least in Google’s eyes. Follow the tips below the help … |
| | Ive have 10 sites I built on Wordpress, 5 of them are ranked on the first page of Yahoo and Altavista and nothing on Google, what happend, Why? What could be wrong as to why they are not ranked on Google.. Thanks Troy |
| | If you want to learn the Google Adword's System then this free ebook will help you. It is an 84 page guide on how to profit with the Google Adwords system. This free ebook will teach you exactly what you need to know to make Adwords work for you! www … |
| | Hi, as far as I understood it yet, * backlinks from your own page have a certain value, * while backlinks with a similar IP but different domain should be better and of course * completely different IP would be best. Could anyone quantify this (at least a little), as … |
 | Hi there I am wanting to add a blog to my website but don't know if it is better to have it as a subdirectory (www.blog.mysite.com) or just as normal (www.mysite.com/blog) Any tips or advice? Thanks |
| | I have started working for a new site last month. Its main keyword for the home page is indexed once, now its not in the SERP. Can anyone here help me to re index my site for that keyword. |
| | hi, Just how important are the meta tags in SEO,or are they overated?could your keywords being in the domain,title and appearing 3 or 4 times in the homepage's article do a good enough job for SEO in a low competition niche? Please give your ideas and suggestions on this Thanks … |
| | We just started a site zoponline.com it's been up for over a month, I added it to yahoos webmaster tools and verified the site but it has not gotten spidered yet. When I log into webmaster tools I see keywords "domain name, values, No. 1, ICANN-accredited, accredited domain name registrar, … |
| | hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …  |
| | I have seen many people ask about the importance of SEO. I would like to share one article about it - www buzzle com/articles/seo-importance-in-business html Give me reviews about it. |
| | Am completing a website and can't get the final piece to work which is the search engine. Have tried implementing Google's OnTheFly script which works up pop up a new window but only puts out "The resource you have requested could not be found." each and everytime. This was the … |
| | Hi, I want to search the log file for a string and extract all data until the end of that line where the search string is found. For example: A line in the file reads like below: [28/04/2010 11:17:53 GMT]PositionPoolCalculation.java(339):getPosCalculation[INFO]BUNP: B123456:1234567:ABCD ANP: B123456:1234567:ABCD:2 post LCN: DESabcdefgh I want to search … |
| | I think you can get more links by submitting to ezine directories. Wouldn't you want to get your clients more links? |
| | Hi, I want to write a script which will search the net based on a few parameters. They are: 1) Find sites which high pr. 2) Sites should have the feature to allow users to register. I know very basic php and I was wondering how I should go about … |
| | Google offer a free "key word" generator that you can locate by search. [url]https://adwords.google.com/select/KeywordToolExternal[/url] Here you can organically find what words are of value and discount the others that are not. I use this tool to rank all of my websites and it is all free. All of my blogs … |
| | As far as I understood it... When Google is to rank a page on a website, it considers the content on this specific page (and backlinks and so on...) and counts the keywords. So, page X would rank for Xs keywords while page Y for Ys, while the landing page … |
 | Yesterday Google updated PageRank. What did you get from this update?  |
| | I am not really familiar with the whole [B]SEO[/B] process but I recently hired someone at <snip> to do the whole process for me. The person there made me know that it is not smart to include a lot of my content in my [B]Javascript[/B] files as they are not … |
| | Does anyone know or have any experience with Google Sites in Googles searches? Do their spiders like when their name is in the domain? |
 | [ATTACH=right]14585[/ATTACH]Google took an interesting step this week when it [URL="http://googlenexusoneboard.blogspot.com/2010/04/update-on-nexus-one-partnerships.html"]announced on its Nexus One blog[/URL] that customers who want to use the Verizon network might be more interested in the [URL="http://phones.verizonwireless.com/htc/incredible/"]HTC Droid Incredible[/URL] instead of its own Nexus One. I've never hidden my disdain for the Google Nexus One strategy … |
| | Hi friends, Pleases suggest me my product pages URL not indexing on Google search page so what can i do for this trouble. |
| | Developers Brad Lassey, Alex Pakhotin, Vladimir Vukićević and Michael Wu this week unveiled what they're calling a pre-alpha version of the Fennec browser, better known as Firefox for Google's Android mobile operating system. You can [url=http://bit.ly/fennec-android]download the code[/url], which as of last week had been tested only on Motorola Droid … |
| | Since the IPad will only operate using Safari and wont support Flash, do you think you will optimize your site to become iPad friendly? |
| | [ATTACH=right]14667[/ATTACH]I've often discussed in this space, [URL="http://www.daniweb.com/news/story255079.html"]the ongoing battle[/URL] among the technology titans--that constant struggle to find the missing link to control the computing world. This week, HP made its move when [URL="http://www.engadget.com/2010/04/28/hp-buys-palm/"]it purchased Palm for $1.2 billion[/URL]. On first blush, it looks like an incredibly stupid step, overpaying for … |
| | Hello, I learned from this forum that posting my websites, web pages, blog articles to social bookmarking sites and they really helped me in SEO. I got indexed on new pages or article blogs in just a weeks or even days. I don't post to popular social bookmarking sites like … |
| | |
| | What's Apple up to now? Yesterday it became public that the company had acquired [url=http://siri.com/]Siri[/url], whose sole purpose in life appears to be to make [url=http://siri.com/about/]Siri[/url], a free iPhone app that helps you find things and make plans. To [url=http://www.youtube.com/watch?v=MpjpVAB06O4&feature=player_embedded]watch Siri in action[/url], it does look pretty useful. But why … |
The End.