7,179 Topics
 | |
 | Hi, I am new to the forum and am looking for some help, my website has a google rating of 4 but when I try to search for it using the terms I would use if searching for my product I never find my site. I have key words and … |
| | Hi there, I have a problem with the search function I designed for my code. [CODE]using System; using System.Collections.Generic; using System.Text; namespace ConsoleApplication { public class Person { public string PerName, PerSal, PerPhone, PerPcode, perState, PerAddress, PerStrenum; public Person(string rec_name, string Srec_sal, string Srec_phone, string Srec_pcode, string rec_state, string rec_address, … |
| | This is a sampling of the basic Internet Marketing tools that are a must-have for every Internet Tool Belt. [URL="http://www.oxzenmedia.com/internet-marketing-tools.php"][/URL] IP Locator Website keyword Density Checker Reverse IP Lookup URL Redirect Tool Website Pagerank Checker  |
| | i want to use google map api for my desktop application. the application will be totally connected to internet. while i was searching some research notes about this implementation. i found a ideal site with the configurations. but it has some java files to be downloaded. but when i tried …  |
 | I am confused. I look through my web analytics report and still see that MSN Live is still referring traffic as well as Bing. So MSN have two search engines. Please explain. Thanks! |
| | Whether reports given by Google Analytics on the no. of visits and the impressions per keyword phrase given by Google Webmasters are accurate results. |
| | This is my first real website, so please forgive my lack of knowledge, I am trying. Please ask any questions if I do not explain my problem well enough. This is where you can find my in progress site [url]http://www.maxxsunglasses.com/development/MaxxWeb2010/products.html[/url] When I click on products or about us or company … |
 | It's no secret that getting quality of back links helps boost website traffic. Here are some techniques to help you get started with link building and SEO: - article submissions - comment on blogs - classified ads - directory listings - link exchange - forum posting - press release - … |
| | Hi Friend, My RSS feed doesn't work in my browser (google chrome) how can I fix it? I have checked so many site but the rss feed subscription is not open in proper way as on Mozilla.. Is any tools for RSS on Google Chrome ? |
 | Hi, I was wondering if any of you knows how google ranks the inerpages of a site. For example mydomain.com has a ranking of 7 but how do I know what is the ranking of the page [url]http://mydomain.com/page2.htm?[/url], |
| | My Page Rank is 1 google shows my site in every search but now google not showing my site in search result and also my PR is 1 what to do now plzz any one tell me |
| | Hi, I'm new to this forum. My other intro thread was deleted as it was considered self-promotion. I am introducing myself as an Online Marketer, because that is what I do, and internet marketing is great in terms of a business. Therefore, I hope to help out others in this …  |
| | Hi Everyone, I have an site which is getting good traffic from google but it's getting very low traffic from other search engines. So please suggest which strategies can be useful for increase my site traffic on yahoo and Bing. Thanks in advance for your valuable guidance |
| | I am beginner php programmer.How can i create dynamic link without using database in php page. For example I have creat a form. When user enter the data and click submit. I want to display submit page in same page. My form page is: [url]www.mysite.com/form.php[/url] and i want to create … |
| | I am totally newbie in this world of earning from google adsense, even I have this blog for a year or so, I did not make too much with it. I have posted some sites which pays me and some payment proofs, as my site is about making money online, … |
| | You may have heard that search engines allow you to submit your website to them. That might sound like a great idea but it is actually a bad idea. Why? Because submitting to search engines means that eventually the search engines will visit your website and their is no promise … |
| | Do you look at the search terms referred from your web analytics and optimize your site accordingly? As I notice the terms that help refer traffic, some terms I am surprised about. I wonder if optimizing for these long tail terms will help bring additional traffic. |
| | Hi all, I would like my program to be able to search for a string using Google and then use the number of results. I'm not sure what exactly this will entail in I/O terms so I guess I'll leave it at that and see what you guys have to … |
| | Have you found these link building services beneficial? I am looking into link building services and I wonder if they are worth it. |
| | A few days ago suddenly Google stoped sending visitors .i had like 2000 + visitors from google daily,now i have 100 . i was a suddenly change,not in time . i don't understand, what could be the reason ? my site (here is the www downloadvyp com link for this …  |
| | Hi Friends, If you’re paying for links or building them manually, it’s becoming more and more important to make it look like you’re gaining them naturally. That’s because, as a site owner, you’re supposed to be gaining them naturally, at least in Google’s eyes. Follow the tips below the help … |
| | Ive have 10 sites I built on Wordpress, 5 of them are ranked on the first page of Yahoo and Altavista and nothing on Google, what happend, Why? What could be wrong as to why they are not ranked on Google.. Thanks Troy |
| | If you want to learn the Google Adword's System then this free ebook will help you. It is an 84 page guide on how to profit with the Google Adwords system. This free ebook will teach you exactly what you need to know to make Adwords work for you! www … |
| | Hi, as far as I understood it yet, * backlinks from your own page have a certain value, * while backlinks with a similar IP but different domain should be better and of course * completely different IP would be best. Could anyone quantify this (at least a little), as … |
 | Hi there I am wanting to add a blog to my website but don't know if it is better to have it as a subdirectory (www.blog.mysite.com) or just as normal (www.mysite.com/blog) Any tips or advice? Thanks |
| | I have started working for a new site last month. Its main keyword for the home page is indexed once, now its not in the SERP. Can anyone here help me to re index my site for that keyword. |
| | hi, Just how important are the meta tags in SEO,or are they overated?could your keywords being in the domain,title and appearing 3 or 4 times in the homepage's article do a good enough job for SEO in a low competition niche? Please give your ideas and suggestions on this Thanks … |
| | We just started a site zoponline.com it's been up for over a month, I added it to yahoos webmaster tools and verified the site but it has not gotten spidered yet. When I log into webmaster tools I see keywords "domain name, values, No. 1, ICANN-accredited, accredited domain name registrar, … |
| | hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …  |
| | I have seen many people ask about the importance of SEO. I would like to share one article about it - www buzzle com/articles/seo-importance-in-business html Give me reviews about it. |
The End.