15,192 Topics
![]() | |
input [CODE=python]import math print(repr(math.pi)) print(str(math.pi)) [/CODE] output [CODE=python]3.141592653589793 3.141592653589793[/CODE] could someone please tell me what the difference between [CODE=python]repr[/CODE] and [CODE=python]str[/CODE] is as the example on the documentation does not help as they both return the same figure? surely it does something more complex? | |
how wud you write a code that wud convert a string of any input into a cool X formation for example if you had a string "names" how would you write it in the formation: [CODE][I]n n a a m e e s s[/I][/CODE] Or for example if you had … | |
Please I downloaded the latest version of python QT but I've been unable to use because i don't know how, help from the experts in the house. Thanks in advance | |
It solves quadratic equations, for both real and complex roots. Please answer the pol to let me know how I'm doing. This function just needs the python 3.x environment, no modules needed. | |
(Python code 3.0) I have been trying to make it that when you the number it will loop around, I tried this: If guess==num: #this is randomly generated number ask for yes or no the playagain if answer==yes replay=1 play_guess==0 if replay=1 play=("yes") however this does not work, please could … | |
Hey, I'm trying to write a program right now with the following requirements: 1. Read a CSV file for field ID#. 2. Compare it to a second CSV file for the same ID # 3. If Csv1ID == Csv2ID, write the rows from both files to outputfile. So basically I … | |
Hi , I have interesting problem as I have a file 'A' which looks like [CODE]>BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]105[/COLOR] 136 [B]Ank[/B] [COLOR="red"]NGCTPLHYAASKDRYEIALMLLENGADPNATD[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]141[/COLOR] 169 [B]Ank [/B] [COLOR="red"]TPLHRASAKGNYRLIQLLLRQSASTNIQD[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]172 [/COLOR] 202 [B]Ank [/B] [COLOR="Red"]GNTPLHLACDEERVEAAKLLVEHGASIYIEN[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"] 40 [/COLOR] 71 … | |
I tried to find the square root of a negative number while writing a function to solve quadratic equations but the interpreter said something , it said math domain error, what does this mean. Even though I've been able to solve the quadratic equation using complex numbers and i will … | |
Hi all, I have the following script for creating scatter plots and I was wondering if there is a way of adding the legends also for each dot in the plot (i.e. Method1, Method2 etc) [code] #!/usr/bin/env python import sys,re,os; import matplotlib as mpl; import matplotlib.pyplot as plt; datafile = … | |
I've been looking for an exercise book for Python, a book that we get some stuff to code, like ideas, and etc. I have already finished the "Invent your own computer games with Python". Is there any other book? Thanks in advance. | |
I want to open a process in the background and it should be invisible in both Linux and Windows. I made something like this, but I don't know the console still appears on the screen: [code] command = "cmd /C dir c:\\" startupinfo = None if os.name == 'nt': startupinfo … | |
I just recently (one week ago) started learning Pyton. I'm using 2.7 as I heard that is best for begginers. I am also following a manual, which is really helpful! The one problem with manuals is that it's very easy to just type whats written and not understand it at … | |
Well just run, the only thing is that this is created using python 3.x. no modules required. | |
Is python 3.2 stable yet, because i use portable python v1.1py3.0.1, so far I'm making improvement, but I have problems loading modules, how do I go about it. | |
Please i just downloaded the latest version of pygame, but I've been finding it difficult to install, okay when i unpacked it, everything came up, but i don't know which should go to which. Python experts in the house what do i do. | |
I'm trying to create a vertical histogram using only built-in modules. I understand the current histogram function isn't truly a histogram (and the code is probably very ugly), but I'm totally lost on how to create a vertical histogram. [CODE]import itertools def histogram(s): print("Histogram:") print("%s %7s %12s" % ( "No.", … | |
[CODE]def main(): i=input() print(i+1)[/CODE] (I use PYTHON 3.2) Why i get an error converting message ? | |
Hi guys this is my very first python program I've been trying to use re.match to test to see if a string is an identifier as defined by this syntax [CODE]identifier -> letter{ letter| digit}[/CODE] I tried the following statements but when i test my program every single time it … | |
Hello all I'm having a few issues with a Python program in that I am performing decimal calculations on and most values come up as desired, however every so often, when there is a very small decimal, the number is represented like "6.80E-7" rather than the desired "0.000000680". Here's a … | |
i am currently running Mac OS 10.5 and i have written and fully debugged (nothing in the command line) a large python script. i am wondering how am i able to create an app for the program. i do not understand the lingo of how to install different libraries and … | |
[CODE]from Tkinter import * master = Tk() def ChangeOpt1(): Options.option_clear() Options.option_add("Apple","Orange","Melon") Options.update() def ChangeOpt2(): Options.option_clear() Options.option_add("Milk","Water","Juice") Options.update() Option1=Checkbutton(text="OPTION1",indicatoron=0,command=ChangeOpt1) Option1.pack() Option2=Checkbutton(text="OPTION2",indicatoron=0,command=ChangeOpt2) Option2.pack() variable = StringVar(master) variable.set("You have to check an option") Options= OptionMenu(master, variable, "You have to check an option") Options.pack() mainloop()[/CODE] I want to do that when I clicked Option1, … | |
Hi DW, I'm extremely new to DaniWeb. I have been coding in C++ for about one month. I'm thinking about coding in Python too. But, I'd like to ask some newbie question's about it first. [B]I'd like to know what it's used for.[/B] [I]I think it's mostly used for web … | |
[CODE]#this function checks if a number is a prime number, #if not it outputs the lowest factor. def isprime(n): """Determines whether a number is a Prime number, Takes a single arguement n, which is the number""" if n==1: return 'Not a Prime number, only has one distinct factor' elif n==2: … | |
I have this code: [CODE]protein="GWEIQPYVWDECYRVFYEQLNEEHKKIFKGIFDCIRDNSAPNLATLVRVTTNHFTHEQAMMDAVKFSEVLPHKKMHRDFLEKLGGLSAPVDNHIKGTDFKYKGKAKNVDYCKEWLVL" pp="LLCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHCLLLCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCL" gor="cccccccccccchhhhhhhhhhhhhhhhhhhhhhhccccccccceeeeecccccchhhhhhhhhhhcccchhhhhhhhhhhhhccccccccccccccccccccccceeceeccceec" aber="CCCCCCCCCCCCHHHHHHHCCHHHCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC" for i in range(len(protein)): print i+1,protein[i], pp[i], gor[i], aber[i] [/CODE] I'm trying to compare these strings. However, the output is in a vertical format. How can I print it so that the format is vertical? This would make it much easier to … | |
This is a program that can calculate, the GPA of a student on a 5.0 scale,it's written in python 3.x and no modules are required. | |
i am tryin to create an app that should make my cellphone work as a webcam ... there are softwres like smart cam for that... also there is an app like mycam that lets you use a gif and create a vistual cam ... i want to know how an … | |
![]() | I had recently made a .bat file that read a couple lines from file.txt and assigned them as variables then went through the execution of the bat which ended up deleting the original file.txt and writing the new values to a new file.txt. Now I want to convert this to … |
I am currently having problems displaying a file correctly once i have written a dictionary to the file. For this program the input file needs to have the format: ID: Date: Dayskept: ProductName e.g. 1:12/12/2011:12:A This is fine the first time I read the example file into a dictionary, but … | |
hi, am trying to parse a multiple pairwise format into table for example: Query= m100529_140129_SMRT1_c0000010190006406181231110_s0_p0/32965/0_332_clipped_50:0 (282 letters) Query: 8 TTTTTGAACAGCCCCAACAACTCTTCCGCTGCCGGTTGCTGCA-TTCCAGTTGTTCCACA 66 ||||||||||||||||||||||||||||||||||||||||||| |||||||||||| ||| Sbjct: 4045830 TTTTTGAACAGCCCCAACAACTCTTCCGCTGCCGGTTGCTGCACTTCCAGTTGTTC-ACA 4045772 Query: 67 GTCCAGCTCCAGTTCAACGTCGGTTTAAATCGTCG--AGCT-GTATGAGAGATAAGCATA 123 | ||||||||||||||||||||||| |||||||| |||| |||||||||||||||| | Sbjct: 4045771 GGTCAGCTCCAGTTCAACGTCGGTTTTAATCGTCGCCAGCTGGTATGAGAGATAAGCA-A 4045713 Query= m100529_140129_SMRT1_c0000010190006406181231110_s0_p0/56521/6_684_clipped_527:0 (151 letters) Query: 1 CTTCAAAGAGGGAGAATTACGTCGATATTACCGAAGGCTGGGAGAAGGGTGAAAATACAA 60 … | |
Obviously, here is the initial code for this blackjack game. and in order for me to feel confident in this game I need to have an error check to make sure that there are at least 7 cards per player. And I have to do this in the second part … |
The End.