15,181 Topics
 | |
| | Is there any way to get a border like this in Tkinter? Notice how it lacks the buttons on the top right. Also I don't want this program to show in the task bar. This is in windows 7, btw.  |
| | If I created Tkinter window with some text that filled the whole window and now wanted to replace the window with a new text, is there a way to refresh the window? For Example: a= 100 win= Tk() win.geometry("500x300") while a > 0: if a%2 == 0: lbl = Label … |
 | Just a curious Question, Is there a way of putting Vpython in wxpython as we do in case of wx.MediaCtrl and other stuffs? |
 | Can someone tell me how to display an image with pygame. By the way I am using python 3.x.  |
| | In my projet, I can't find how to determine which image and pixel coordonate at clicking image in different ScrollArea. The result was showing in statusBar() area. (See screenshot) I put a code in txt file with 2 jpg use with it. Thanks in advance. |
| | Please help me with this bug. I have python 3.0 and I was using pygame and for some reason it isn't reconizing [CODE]windowSurface[/CODE] here Is the code Im having problems with and thanks in advance. [CODE]import pygame, sys, random from pygame.locals import * #*******************************************SETUPVAR************************************************** BLACK = (0, 0, 0) WHITE … |
| | I have this sequence in the text file >sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG HGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE TMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQD QYGEPPSQRVMLGDERHGARESFLD I want to split this into list as [[COLOR="Red"]'[/COLOR]>sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1][COLOR="Red"]'[/COLOR],[COLOR="Red"]'[/COLOR]MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG … |
 | Hello friends, I have a small problem with printing/getting exceptions in 3.1 version. My code is: [CODE=Python] try: # bla bla... except Exception, e: # here I got error message "Invalid Syntax" in the comma self.setError(e) return False [/CODE] What is the correct syntax in python 3.1 to get the … |
| | Hi Everyone, Thanks in advance for any help. I am fairly new to programming python, and I and another person are developing a simple educational (graphical) tool that shows variable referencing for any python code that I run in my own defined local and global name spaces. The problem I …  |
| | anyone knows how to launch an application, for example, a .exe, in mac?? this code works for me in ubuntu, i tried it in mac but its not working: [CODE]os.system('gnome-open ' + path)[/CODE] |
| | I am wondering how to write a function that prints values of tree nodes from a root to a lowest child. If the tree looks like [CODE] 1 2 3 4 5 6 7 8[/CODE] then the output should be 1 3 6 8. My function is [CODE]def traverse(node): if … |
| | How would you modify this gui code to designate only certain spots on your canvas to drop your image? Like when your playing solitaire and the game only allows you to drop your card in a certain spot. [URL="http://www.daniweb.com/forums/post1111987.html#post1111987"]http://www.daniweb.com/forums/post1111987.html#post1111987[/URL] |
 | Is there a way to accomplish the following in python? [CODE=javascript] try{ // something } catch (e) { // display e.message, e.name, e.linenumber } [/CODE]  |
| | Hi, First off, I'm a real greenhorn so please forgive me asking questions which may be bleeding obvious, but I have searched and searched and cannot find an answer to my problem. I'm trying to import a CSV file into sqlite3 database in python. The CSV file has 56 columns … |
| | What approach should I use to return all dict keys that have the maximum value. The code below outputs 1, but I would like for it to return 1, 2. [CODE]import operator d1 = dict() d1[0] = 1 d1[1] = 2 d1[2] = 2 maxValue = max(d1.iteritems(), key=operator.itemgetter(1))[0] [/CODE] |
| | Ive been trying to make a simple program that if i press the 'TAB' button it automatically presses 'Alt' (in a loop) Also i want it to work when python isnt the main program im using, like say a macro program. import pygame while True: if pygame.K_TAB: ye nvm im … |
| | Hi, I'm using BeautifulSoup to parst html pages. I wrote a recursive function to traverse the parsed tree and extract NavigableStrings, add them to a string. Then return the string. The problem is my recursive skills sucks. I know I'm initializing the (Text) string each time the function is called. … |
| | im a newbie to python, still learning as of today. as a part of my 'self-training' i listed some topics to practice every week but i was not able to run it successfully and im stuck. what i wanted with my activity is for it to read a .txt file … |
 | Hello people, I am currently working on a program for comparing texts. Everything is working fine thanks to your help. However, I would like to have my program resize everything when the player resizes the main Window. I have managed to do so, but something feels amiss... Can you help … |
| | Hi, a simple question: how do I enable deleting inside a python program? I have a python program that asks for user input, users write some words and then press enter. The problem is they can't use backspace or supr to delete anything, instead, the program prints ^? each time … |
| | I'm writing a code that should extract tags from an HTML code (I'm skipping parts about parsing and stuff). I'm testing it using a simple fixed string however, it doesn't remove this <div> tag and I have no idea why... Thanks... [CODE]import re RegExpression_Tags = r"<.*?>" html = """ <div … |
 | This bot has some common functions, along with some not so common. I've been using this code to text my wife from work when my phone dies. Requirements: [LIST] [*]Gmail account (for texting) [*]xgoogle (for lang translation) [/LIST] I know it is messy, and the variables are named poorly; sorry. … |
 | Are they any tool that can help build nice looking , easy to use installer, that will be strictly GUI based, no command line magic, for my end user for a programm I am building. If it is possible I would like to bundle inside my installation python and pygame, … |
 | [CODE]from Tkinter import * import tkMessageBox import pygame.mixer # create GUI window app = Tk() app.title("Head Frist Mix") sound_file = "50459_M_RED_Nephlimizer.wav" # start the sounds system mixer = pygame.mixer mixer.init() # create function def track_toggle(): if track_playing.get() == 1: track.play(loops = -1) else: track.stop() # create function volume def change_volume(v): … |
| | I want to crawl my gf's xanga's post into my computer for better reading but it require me to login before viewing the post I am wondering ,can python crawl this password protected webpage? I already have the id and password, because that is my id. the login webpage, for … |
| | hey, thanks to all of them who helps me in learning this language, again there is one text file file 1.txt >[B]sp|P81928[/B][/B]|140U_DROME 67 198 Tim17 8.9e-19 No_clan >[B][/B]sp|P20905|5HT1R_DROME 179 507 7tm_1 1.1e-97 CL0192 >sp|P28285|5HT2A_DROME 243 805 7tm_1 3.2e-73 CL0192 >sp[B][/B]|P28286|5HT2B_DROME 107 588 7tm_1 7.2e-82 CL0192 * here the number represents … |
| | Hi, I have a window and open another window with a button. Then, when the other window is closed I need to update some fields in the first one. Here's what I currently do: MainWindow: [code=python] ... self.connect(self.actionCustomFactors, SIGNAL("triggered()"), self.OnCustomFactorsTriggered) ... def OnCustomFactorsTriggered(self): self.customWin = CustomWindow(self.factorsFile) self.customWin.show() self.connect(self.customWin, SIGNAL("destroyed()"), self.OnCustomWinClosed) … |
| | something like this: open red box with key or open red box to be broken down to open as .group("verb"), red box as .group("object"), with as .group("preposition"), and key as .group("indirectobj") my current pattern is [icode]"^(?P<verb>open)\W*(?P<object>\w*\W{1})\W*(?P<preposition>with|\Z)\W*(?P<indirectobj>\w*)"[/icode] it's not working, and i'm kinda out of ideas. |
| | So, I have this code snippet where I read a text from a TXT-file: [code] file = open('test.txt', 'r') content = file.readlines() file.close() print(content) [/code] The printout: [code] ['My name is x.\n', 'I am 45 years old.\n', '\n', 'My girlfriends name is y.\n', 'She is way too old for me.\n', … |
| | Check this out: [URL="http://www.lfd.uci.edu/~gohlke/pythonlibs/"]Unofficial Windows Binaries for Python Extension Packages[/URL] |
The End.